Lineage for d1dora_ (1dor A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570660Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 570661Family c.1.4.1: FMN-linked oxidoreductases [51396] (15 proteins)
  6. 570690Protein Dihydroorotate dehydrogenase [51397] (5 species)
  7. 570699Species Lactococcus lactis, isozyme A [TaxId:1358] [51398] (9 PDB entries)
  8. 570710Domain d1dora_: 1dor A: [28595]

Details for d1dora_

PDB Entry: 1dor (more details), 2 Å

PDB Description: dihydroorotate dehydrogenase a from lactococcus lactis

SCOP Domain Sequences for d1dora_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dora_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl

SCOP Domain Coordinates for d1dora_:

Click to download the PDB-style file with coordinates for d1dora_.
(The format of our PDB-style files is described here.)

Timeline for d1dora_: