Lineage for d1dora_ (1dor A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18552Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 18553Family c.1.4.1: FMN-linked oxidoreductases [51396] (6 proteins)
  6. 18554Protein Dihydroorotate dehydrogenase [51397] (3 species)
  7. 18558Species Lactococcus lactis, isozyme A [TaxId:1358] [51398] (2 PDB entries)
  8. 18561Domain d1dora_: 1dor A: [28595]

Details for d1dora_

PDB Entry: 1dor (more details), 2 Å

PDB Description: dihydroorotate dehydrogenase a from lactococcus lactis

SCOP Domain Sequences for d1dora_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dora_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A}
mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
iadfhgklksl

SCOP Domain Coordinates for d1dora_:

Click to download the PDB-style file with coordinates for d1dora_.
(The format of our PDB-style files is described here.)

Timeline for d1dora_: