Lineage for d1qo2b_ (1qo2 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570417Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (5 families) (S)
  5. 570418Family c.1.2.1: Histidine biosynthesis enzymes [51367] (2 proteins)
    structural evidence for the gene duplication within the barrel fold
  6. 570440Protein Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA [51368] (1 species)
  7. 570441Species Thermotoga maritima [TaxId:243274] [51369] (1 PDB entry)
  8. 570443Domain d1qo2b_: 1qo2 B: [28534]

Details for d1qo2b_

PDB Entry: 1qo2 (more details), 1.85 Å

PDB Description: crystal structure of n-((5'-phosphoribosyl)-formimino)-5- aminoimidazol-4-carboxamid ribonucleotid isomerase (ec 3.1.3.15, hisa)

SCOP Domain Sequences for d1qo2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo2b_ c.1.2.1 (B:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima}
mlvvpaidlfrgkvarmikgrkentifyekdpvelveklieegftlihvvdlsnaiensg
enlpvleklsefaehiqigggirsldyaeklrklgyrrqivsskvledpsflkslreidv
epvfsldtrggrvafkgwlaeeeidpvsllkrlkeygleeivhteiekdgtlqehdfslt
kkiaieaevkvlaaggissenslktaqkvhtetngllkgvivgraflegiltvevmkrya
r

SCOP Domain Coordinates for d1qo2b_:

Click to download the PDB-style file with coordinates for d1qo2b_.
(The format of our PDB-style files is described here.)

Timeline for d1qo2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qo2a_