Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins) structural evidence for the gene duplication within the barrel fold automatically mapped to Pfam PF00977 |
Protein Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA [51368] (2 species) |
Species Thermotoga maritima [TaxId:2336] [51369] (2 PDB entries) |
Domain d1qo2b_: 1qo2 B: [28534] |
PDB Entry: 1qo2 (more details), 1.85 Å
SCOPe Domain Sequences for d1qo2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qo2b_ c.1.2.1 (B:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} mlvvpaidlfrgkvarmikgrkentifyekdpvelveklieegftlihvvdlsnaiensg enlpvleklsefaehiqigggirsldyaeklrklgyrrqivsskvledpsflkslreidv epvfsldtrggrvafkgwlaeeeidpvsllkrlkeygleeivhteiekdgtlqehdfslt kkiaieaevkvlaaggissenslktaqkvhtetngllkgvivgraflegiltvevmkrya r
Timeline for d1qo2b_: