Lineage for d1b9bb_ (1b9b B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1565957Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1565958Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 1565959Protein Triosephosphate isomerase [51353] (20 species)
  7. 1566145Species Thermotoga maritima [TaxId:2336] [51365] (1 PDB entry)
  8. 1566147Domain d1b9bb_: 1b9b B: [28532]
    complexed with so4

Details for d1b9bb_

PDB Entry: 1b9b (more details), 2.85 Å

PDB Description: triosephosphate isomerase of thermotoga maritima
PDB Compounds: (B:) protein (triosephosphate isomerase)

SCOPe Domain Sequences for d1b9bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9bb_ c.1.1.1 (B:) Triosephosphate isomerase {Thermotoga maritima [TaxId: 2336]}
itrklilagnwkmhktiseakkfvsllvnelhdvkefeivvcppftalsevgeilsgrni
klgaqnvfyedqgaftgeisplmlqeigveyvivghserrrifkeddefinrkvkavlek
gmtpilcvgetleerekgltfcvvekqvregfygldkeeakrvviayepvwaigtgrvat
pqqaqevhafirkllsemydeetagsirilyggsikpdnflglivqkdidgglvggaslk
esfielarimrgvis

SCOPe Domain Coordinates for d1b9bb_:

Click to download the PDB-style file with coordinates for d1b9bb_.
(The format of our PDB-style files is described here.)

Timeline for d1b9bb_: