Lineage for d1b9bb_ (1b9b B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18354Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 18355Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 18356Protein Triosephosphate isomerase [51353] (12 species)
  7. 18405Species Thermotoga maritima [TaxId:243274] [51365] (1 PDB entry)
  8. 18407Domain d1b9bb_: 1b9b B: [28532]

Details for d1b9bb_

PDB Entry: 1b9b (more details), 2.85 Å

PDB Description: triosephosphate isomerase of thermotoga maritima

SCOP Domain Sequences for d1b9bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9bb_ c.1.1.1 (B:) Triosephosphate isomerase {Thermotoga maritima}
itrklilagnwkmhktiseakkfvsllvnelhdvkefeivvcppftalsevgeilsgrni
klgaqnvfyedqgaftgeisplmlqeigveyvivghserrrifkeddefinrkvkavlek
gmtpilcvgetleerekgltfcvvekqvregfygldkeeakrvviayepvwaigtgrvat
pqqaqevhafirkllsemydeetagsirilyggsikpdnflglivqkdidgglvggaslk
esfielarimrgvis

SCOP Domain Coordinates for d1b9bb_:

Click to download the PDB-style file with coordinates for d1b9bb_.
(The format of our PDB-style files is described here.)

Timeline for d1b9bb_: