SCOPe 2.01: Domain d1tpwb_: 1tpw B:

Lineage for d1tpwb_ (1tpw B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (20 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [51354] (16 PDB entries)
   Uniprot P00940

8. Domain d1tpwb_: 1tpw B: [28450]
   complexed with pgh

Details for d1tpwb_

PDB Entry: 1tpw, 1.9 Å

PDB Description: triosephosphate isomerase drinks water to keep healthy

PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d1tpwb_:

Sequence; same for both SEQRES and ATOM records:

>d1tpwb_ c.1.1.1 (B:) Triosephosphate isomerase {Chicken (Gallus gallus) [TaxId: 9031]}
rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
qncykvpkgaftgeispamikdigaawvilghperrhvfgesdeligqkvahalaeglgv
iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
inakh

Timeline for d1tpwb_:

• d1tpwb_ first appeared (with stable ids) in SCOP 1.55
  
• d1tpwb_ appears in SCOP 1.75
  
• d1tpwb_ appears in SCOPe 2.02
  
• d1tpwb_ appears in the current release, SCOPe 2.08