PDB entry 1tpw

View 1tpw on RCSB PDB site
Description: triosephosphate isomerase drinks water to keep healthy
Class: isomerase(intramolecular oxidoreductase)
Keywords: isomerase(intramolecular oxidoreductase)
Deposited on 1994-11-07, released 1995-04-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00940 (Start-246)
      • conflict (94)
      • conflict (192)
    Domains in SCOPe 2.01: d1tpwa_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00940 (Start-246)
      • conflict (94)
      • conflict (192)
    Domains in SCOPe 2.01: d1tpwb_
  • Heterogens: PGH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tpwA (A:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghperrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tpwA (A:)
    rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
    qncykvpkgaftgeispamikdigaawvilghperrhvfgesdeligqkvahalaeglgv
    iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
    vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
    inakh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tpwB (B:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghperrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tpwB (B:)
    rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
    qncykvpkgaftgeispamikdigaawvilghperrhvfgesdeligqkvahalaeglgv
    iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
    vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
    inakh