Class b: All beta proteins [48724] (111 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (3 families) |
Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein) |
Protein alpha-Subunit of urease [51340] (3 species) |
Species Bacillus pasteurii [TaxId:1474] [51342] (5 PDB entries) |
Domain d2ubpc1: 2ubp C:1-131,C:435-483 [28433] Other proteins in same PDB: d2ubpa_, d2ubpb_, d2ubpc2 |
PDB Entry: 2ubp (more details), 2 Å
SCOP Domain Sequences for d2ubpc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii} mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt v
Timeline for d2ubpc1: