Lineage for d2ubpc1 (2ubp C:1-131,C:435-483)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 235294Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 235295Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (6 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 235296Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)
  6. 235297Protein alpha-Subunit of urease [51340] (3 species)
  7. 235298Species Bacillus pasteurii [TaxId:1474] [51342] (5 PDB entries)
  8. 235302Domain d2ubpc1: 2ubp C:1-131,C:435-483 [28433]
    Other proteins in same PDB: d2ubpa_, d2ubpb_, d2ubpc2

Details for d2ubpc1

PDB Entry: 2ubp (more details), 2 Å

PDB Description: structure of native urease from bacillus pasteurii

SCOP Domain Sequences for d2ubpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii}
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt
v

SCOP Domain Coordinates for d2ubpc1:

Click to download the PDB-style file with coordinates for d2ubpc1.
(The format of our PDB-style files is described here.)

Timeline for d2ubpc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ubpc2