SCOPe 2.06: Domain d1b12c_: 1b12 C:

Lineage for d1b12c_ (1b12 C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
   complex fold made of several coiled beta-sheets; contains an SH3-like barrel

4. Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families)

5. Family b.87.1.2: Type 1 signal peptidase [51312] (1 protein)
   contains additional all-beta subdomain inserted in the superfamily fold

6. Protein Type 1 signal peptidase [51313] (1 species)

7. Species Escherichia coli [TaxId:562] [51314] (5 PDB entries)
   Uniprot P00803 81-324

8. Domain d1b12c_: 1b12 C: [28390]
   complexed with 1pn, po4

Details for d1b12c_

PDB Entry: 1b12, 1.95 Å

PDB Description: crystal structure of type 1 signal peptidase from escherichia coli in complex with a beta-lactam inhibitor

PDB Compounds: (C:) Signal peptidase I

SCOPe Domain Sequences for d1b12c_:

Sequence, based on SEQRES records:

>d1b12c_ b.87.1.2 (C:) Type 1 signal peptidase {Escherichia coli [TaxId: 562]}
sfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfkype
dpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtfs
rrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpgqq
latwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptglrls
riggih

Sequence, based on observed residues (ATOM records):

>d1b12c_ b.87.1.2 (C:) Type 1 signal peptidase {Escherichia coli [TaxId: 562]}
sfiyepfqipsgsmmptlligdfilvekfatghpkrgdivvfkypedpkldyikravglp
gdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtfsatsgffevpknetk
engirlserketlgdvthriltvpiaqdqvgmyyqqpgqqlatwivppgqyfmmgdnrdn
sadsrywgfvpeanlvgrataiwmsfdkqegewptglrlsriggih

Timeline for d1b12c_:

• d1b12c_ first appeared (with stable ids) in SCOP 1.55
  
• d1b12c_ appears in SCOPe 2.05
  
• d1b12c_ appears in SCOPe 2.07
  
• d1b12c_ appears in the current release, SCOPe 2.08