Lineage for d1b12c_ (1b12 C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18251Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
  4. 18252Superfamily b.87.1: LexA/Signal peptidase [51306] (2 families) (S)
  5. 18264Family b.87.1.2: Type 1 signal peptidase [51312] (1 protein)
  6. 18265Protein Type 1 signal peptidase [51313] (1 species)
  7. 18266Species Escherichia coli [TaxId:562] [51314] (1 PDB entry)
  8. 18269Domain d1b12c_: 1b12 C: [28390]

Details for d1b12c_

PDB Entry: 1b12 (more details), 1.95 Å

PDB Description: crystal structure of type 1 signal peptidase from escherichia coli in complex with a beta-lactam inhibitor

SCOP Domain Sequences for d1b12c_:

Sequence, based on SEQRES records: (download)

>d1b12c_ b.87.1.2 (C:) Type 1 signal peptidase {Escherichia coli}
sfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfkype
dpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtfs
rrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpgqq
latwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptglrls
riggih

Sequence, based on observed residues (ATOM records): (download)

>d1b12c_ b.87.1.2 (C:) Type 1 signal peptidase {Escherichia coli}
sfiyepfqipsgsmmptlligdfilvekfatghpkrgdivvfkypedpkldyikravglp
gdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtfsatsgffevpknetk
engirlserketlgdvthriltvpiaqdqvgmyyqqpgqqlatwivppgqyfmmgdnrdn
sadsrywgfvpeanlvgrataiwmsfdkqegewptglrlsriggih

SCOP Domain Coordinates for d1b12c_:

Click to download the PDB-style file with coordinates for d1b12c_.
(The format of our PDB-style files is described here.)

Timeline for d1b12c_: