Lineage for d1duda1 (1dud A:2-136)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818072Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2818142Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 2818146Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
    Uniprot P06968
  8. 2818156Domain d1duda1: 1dud A:2-136 [28352]
    Other proteins in same PDB: d1duda2
    complexed with dud

Details for d1duda1

PDB Entry: 1dud (more details), 2.3 Å

PDB Description: deoxyuridine 5'-triphosphate nucleotide hydrolase (d-utpase) complexed with the substrate analogue deoxyuridine 5'-diphosphate (d-udp)
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1duda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duda1 b.85.4.1 (A:2-136) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihiad
pslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqmi
fvpvvqaefnlvedf

SCOPe Domain Coordinates for d1duda1:

Click to download the PDB-style file with coordinates for d1duda1.
(The format of our PDB-style files is described here.)

Timeline for d1duda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1duda2