Lineage for d1duda1 (1dud A:2-136)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.85: beta-clip [51268] (7 superfamilies)
double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
Superfamily b.85.4: dUTPase-like [51283] (2 families) 
forms tight trimer through an additional beta-sheet in each subunit
subunit beta-sheets are orthogonally packed around the three-fold axis
Family b.85.4.1: dUTPase-like [51284] (5 proteins) Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species) 
Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
Uniprot P06968
Domain d1duda1: 1dud A:2-136 [28352]
Other proteins in same PDB: d1duda2
complexed with dud
Details for d1duda1
PDB Entry: 1dud (more details), 2.3 Å
PDB Description: deoxyuridine 5'-triphosphate nucleotide hydrolase (d-utpase) complexed with the substrate analogue deoxyuridine 5'-diphosphate (d-udp)
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolaseSCOPe Domain Sequences for d1duda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1duda1 b.85.4.1 (A:2-136) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihiad
pslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqmi
fvpvvqaefnlvedf
SCOPe Domain Coordinates for d1duda1:
Click to download the PDB-style file with coordinates for d1duda1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1duda1:
- d1duda1 first appeared (with stable ids) in SCOP 1.55, called d1dud__
- d1duda1 appears in SCOPe 2.07
View in 3D
