SCOPe 2.08: Structural Classification of Proteins

PDB entry 1dud

View 1dud on RCSB PDB site
Description: deoxyuridine 5'-triphosphate nucleotide hydrolase (d-utpase) complexed with the substrate analogue deoxyuridine 5'-diphosphate (d-udp)
Class: hydrolase
Keywords: hydrolase, nucleotide metabolism, d-utpase, substrate analogue, d-udp complex
Deposited on 1996-04-30, released 1996-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P06968 (1-End)
Domains in SCOPe 2.08: d1duda1, d1duda2
Heterogens: DUD, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1dudA (A:)
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfdatdrgeggfghsgrq

Sequence, based on observed residues (ATOM records): (download)

>1dudA (A:)
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedf