Lineage for d1eu5a_ (1eu5 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332308Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1332444Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1332445Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1332515Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 1332519Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
    Uniprot P06968
  8. 1332521Domain d1eu5a_: 1eu5 A: [28350]
    complexed with gol

Details for d1eu5a_

PDB Entry: 1eu5 (more details), 1.45 Å

PDB Description: structure of e. coli dutpase at 1.45 a
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1eu5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eu5a_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedf

SCOPe Domain Coordinates for d1eu5a_:

Click to download the PDB-style file with coordinates for d1eu5a_.
(The format of our PDB-style files is described here.)

Timeline for d1eu5a_: