Lineage for d1eu5a1 (1eu5 A:2-136)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.85: beta-clip [51268] (7 superfamilies)
double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
Superfamily b.85.4: dUTPase-like [51283] (2 families) 
forms tight trimer through an additional beta-sheet in each subunit
subunit beta-sheets are orthogonally packed around the three-fold axis
Family b.85.4.1: dUTPase-like [51284] (5 proteins) Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species) 
Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
Uniprot P06968
Domain d1eu5a1: 1eu5 A:2-136 [28350]
Other proteins in same PDB: d1eu5a2
complexed with gol
Details for d1eu5a1
PDB Entry: 1eu5 (more details), 1.45 Å
PDB Description: structure of e. coli dutpase at 1.45 a
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolaseSCOPe Domain Sequences for d1eu5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eu5a1 b.85.4.1 (A:2-136) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihiad
pslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqmi
fvpvvqaefnlvedf
SCOPe Domain Coordinates for d1eu5a1:
Click to download the PDB-style file with coordinates for d1eu5a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eu5a1:
- d1eu5a1 first appeared (with stable ids) in SCOP 1.55, called d1eu5a_
- d1eu5a1 appears in SCOPe 2.07
View in 3D
