Lineage for d1eu5a_ (1eu5 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.85: beta-clip [51268] (5 superfamilies) Superfamily b.85.4: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51283] (1 family) 
Family b.85.4.1: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51284] (1 protein) Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (3 species) Species Escherichia coli [TaxId:562] [51286] (4 PDB entries) 
Domain d1eu5a_: 1eu5 A: [28350]
Details for d1eu5a_
PDB Entry: 1eu5 (more details), 1.45 Å
PDB Description: structure of e. coli dutpase at 1.45 a
SCOP Domain Sequences for d1eu5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eu5a_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedf
SCOP Domain Coordinates for d1eu5a_:
Click to download the PDB-style file with coordinates for d1eu5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eu5a_:
- d1eu5a_ appears in SCOP 1.57
- d1eu5a_ appears in the current release, SCOPe 2.08, called d1eu5a1
View in 3D