Lineage for d1ggra_ (1ggr A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2427078Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) (S)
    half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets
  5. 2427079Family b.84.3.1: Glucose permease-like [51262] (3 proteins)
  6. 2427086Protein Glucose-specific factor III (glsIII) [51266] (1 species)
    synonym: enzyme IIa-glc
  7. 2427087Species Escherichia coli [TaxId:562] [51267] (11 PDB entries)
  8. 2427098Domain d1ggra_: 1ggr A: [28279]
    Other proteins in same PDB: d1ggrb_
    complexed with po3

Details for d1ggra_

PDB Entry: 1ggr (more details)

PDB Description: complex of enzyme iiaglc and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
PDB Compounds: (A:) pts system, glucose-specific iia component

SCOPe Domain Sequences for d1ggra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggra_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]}
tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs
iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv
visnmdeikeliklsgsvtvgetpvirikk

SCOPe Domain Coordinates for d1ggra_:

Click to download the PDB-style file with coordinates for d1ggra_.
(The format of our PDB-style files is described here.)

Timeline for d1ggra_: