SCOP 1.63: Domain d1f3g__: 1f3g -

Lineage for d1f3g__ (1f3g -)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.3: Duplicated hybrid motif [51261] (1 family)
   half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets

5. Family b.84.3.1: Glucose permease-like [51262] (2 proteins)

6. Protein Glucose-specific factor III (glsIII) [51266] (1 species)
   synonym: enzyme IIa-glc

7. Species Escherichia coli [TaxId:562] [51267] (9 PDB entries)

8. Domain d1f3g__: 1f3g - [28272]

Details for d1f3g__

PDB Entry: 1f3g, 2.1 Å

PDB Description: three-dimensional structure of the escherichia coli phosphocarrier protein iii glc

SCOP Domain Sequences for d1f3g__:

Sequence; same for both SEQRES and ATOM records:

>d1f3g__ b.84.3.1 (-) Glucose-specific factor III (glsIII) {Escherichia coli}
tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs
iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv
visnmdeikeliklsgsvtvgetpvirikk

Timeline for d1f3g__:

• d1f3g__ first appeared (with stable ids) in SCOP 1.55
  
• d1f3g__ appears in SCOP 1.61
  
• d1f3g__ appears in SCOP 1.65
  
• d1f3g__ appears in the current release, SCOPe 2.08, called d1f3ga_