| Class b: All beta proteins [48724] (177 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) ![]() half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets |
| Family b.84.3.1: Glucose permease-like [51262] (3 proteins) |
| Protein Glucose permease IIa domain, IIa-glc [51263] (2 species) |
| Species Bacillus subtilis [TaxId:1423] [51264] (2 PDB entries) |
| Domain d1gpra_: 1gpr A: [28267] |
PDB Entry: 1gpr (more details), 1.9 Å
SCOPe Domain Sequences for d1gpra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]}
eplqneigeevfvspitgeihpitdvpdqvfsgkmmgdgfailpsegivvspvrgkilnv
fptkhaiglqsdggreilihfgidtvslkgegftsfvsegdrvepgqkllevdldavkpn
vpslmtpivftnlaegetvsikasgsvnreqedivkie
Timeline for d1gpra_: