Lineage for d1gpra_ (1gpr A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817734Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) (S)
    half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets
  5. 2817735Family b.84.3.1: Glucose permease-like [51262] (3 proteins)
  6. 2817736Protein Glucose permease IIa domain, IIa-glc [51263] (2 species)
  7. 2817737Species Bacillus subtilis [TaxId:1423] [51264] (2 PDB entries)
  8. 2817738Domain d1gpra_: 1gpr A: [28267]

Details for d1gpra_

PDB Entry: 1gpr (more details), 1.9 Å

PDB Description: refined crystal structure of iia domain of the glucose permease of bacillus subtilis at 1.9 angstroms resolution
PDB Compounds: (A:) glucose permease

SCOPe Domain Sequences for d1gpra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]}
eplqneigeevfvspitgeihpitdvpdqvfsgkmmgdgfailpsegivvspvrgkilnv
fptkhaiglqsdggreilihfgidtvslkgegftsfvsegdrvepgqkllevdldavkpn
vpslmtpivftnlaegetvsikasgsvnreqedivkie

SCOPe Domain Coordinates for d1gpra_:

Click to download the PDB-style file with coordinates for d1gpra_.
(The format of our PDB-style files is described here.)

Timeline for d1gpra_: