Class b: All beta proteins [48724] (177 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) |
Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins) probable rudiment form of the biotinyl-carrier domain |
Protein Glycinamide ribonucleotide transformylase PurT, C-domain [51254] (1 species) |
Species Escherichia coli [TaxId:562] [51255] (7 PDB entries) |
Domain d1eyza1: 1eyz A:319-392 [28246] Other proteins in same PDB: d1eyza2, d1eyza3, d1eyzb2, d1eyzb3 complexed with anp, cl, mg, mpo, na |
PDB Entry: 1eyz (more details), 1.75 Å
SCOPe Domain Sequences for d1eyza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eyza1 b.84.2.1 (A:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli [TaxId: 562]} gpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgvalataesvvdai erakhaagqvkvqg
Timeline for d1eyza1: