Lineage for d1eyza1 (1eyz A:319-392)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18007Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
  4. 18044Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 18045Family b.84.2.1: BC C-terminal domain-like [51247] (4 proteins)
  6. 18057Protein Glycinamide ribonucleotide transformylase PurT [51254] (1 species)
  7. 18058Species Escherichia coli [TaxId:562] [51255] (2 PDB entries)
  8. 18059Domain d1eyza1: 1eyz A:319-392 [28246]
    Other proteins in same PDB: d1eyza2, d1eyza3, d1eyzb2, d1eyzb3

Details for d1eyza1

PDB Entry: 1eyz (more details), 1.75 Å

PDB Description: structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp

SCOP Domain Sequences for d1eyza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eyza1 b.84.2.1 (A:319-392) Glycinamide ribonucleotide transformylase PurT {Escherichia coli}
gpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgvalataesvvdai
erakhaagqvkvqg

SCOP Domain Coordinates for d1eyza1:

Click to download the PDB-style file with coordinates for d1eyza1.
(The format of our PDB-style files is described here.)

Timeline for d1eyza1: