Lineage for d1eyza1 (1eyz A:319-392)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 964158Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 964233Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 964234Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 964267Protein Glycinamide ribonucleotide transformylase PurT, C-domain [51254] (1 species)
  7. 964268Species Escherichia coli [TaxId:562] [51255] (7 PDB entries)
  8. 964279Domain d1eyza1: 1eyz A:319-392 [28246]
    Other proteins in same PDB: d1eyza2, d1eyza3, d1eyzb2, d1eyzb3
    complexed with anp, cl, mg, mpo, na

Details for d1eyza1

PDB Entry: 1eyz (more details), 1.75 Å

PDB Description: structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp
PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase 2

SCOPe Domain Sequences for d1eyza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eyza1 b.84.2.1 (A:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli [TaxId: 562]}
gpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgvalataesvvdai
erakhaagqvkvqg

SCOPe Domain Coordinates for d1eyza1:

Click to download the PDB-style file with coordinates for d1eyza1.
(The format of our PDB-style files is described here.)

Timeline for d1eyza1: