SCOPe 2.07: Domain d1fyca_: 1fyc A:

Lineage for d1fyca_ (1fyc A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
   component of the pyruvate dehydrogenase complex

7. Species Human (Homo sapiens) [TaxId:9606] [51242] (8 PDB entries)

8. Domain d1fyca_: 1fyc A: [28230]

Details for d1fyca_

PDB Entry: 1fyc

PDB Description: inner lipoyl domain from human pyruvate dehydrogenase (pdh) complex, nmr, 1 structure

PDB Compounds: (A:) dihydrolipoamide acetyltransferase (e2p)

SCOPe Domain Sequences for d1fyca_:

Sequence; same for both SEQRES and ATOM records:

>d1fyca_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
gsnmsypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqee
gylakilvpegtrdvplgtplciivekeadisafadyrptevtdlk

Timeline for d1fyca_:

• d1fyca_ first appeared (with stable ids) in SCOP 1.55, called d1fyc__
  
• d1fyca_ appears in SCOPe 2.06
  
• d1fyca_ appears in the current release, SCOPe 2.08