Lineage for d1fyca_ (1fyc A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072005Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2072006Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2072007Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 protein domains)
  6. 2072019Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
    component of the pyruvate dehydrogenase complex
  7. 2072028Species Human (Homo sapiens) [TaxId:9606] [51242] (8 PDB entries)
  8. 2072039Domain d1fyca_: 1fyc A: [28230]

Details for d1fyca_

PDB Entry: 1fyc (more details)

PDB Description: inner lipoyl domain from human pyruvate dehydrogenase (pdh) complex, nmr, 1 structure
PDB Compounds: (A:) dihydrolipoamide acetyltransferase (e2p)

SCOPe Domain Sequences for d1fyca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyca_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
gsnmsypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqee
gylakilvpegtrdvplgtplciivekeadisafadyrptevtdlk

SCOPe Domain Coordinates for d1fyca_:

Click to download the PDB-style file with coordinates for d1fyca_.
(The format of our PDB-style files is described here.)

Timeline for d1fyca_: