| Class b: All beta proteins [48724] (176 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
| Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
| Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species) component of the pyruvate dehydrogenase complex |
| Species Azotobacter vinelandii [TaxId:354] [51240] (2 PDB entries) |
| Domain d1iyua_: 1iyu A: [28227] |
PDB Entry: 1iyu (more details)
SCOPe Domain Sequences for d1iyua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]}
seiirvpdiggdgeviellvktgdlieveqglvvlesakasmevpspkagvvksvsvklg
dklkegdaiielepaagar
Timeline for d1iyua_: