Lineage for d1iyu__ (1iyu -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies) 
Superfamily b.84.1: Single hybrid motif [51230] (1 family) 
Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (5 proteins) 
Protein Ipoyl domain of dihydrolipoamide acetyltransferase [51238] (4 species) Species Azotobacter vinelandii [TaxId:354] [51240] (2 PDB entries) 
Domain d1iyu__: 1iyu - [28227]
Details for d1iyu__
PDB Entry: 1iyu (more details)
PDB Description: lipoyl domain of pyruvate dehydrogenase complex, nmr, minimized average structure
SCOP Domain Sequences for d1iyu__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iyu__ b.84.1.1 (-) Ipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii}
seiirvpdiggdgeviellvktgdlieveqglvvlesakasmevpspkagvvksvsvklg
dklkegdaiielepaagar
SCOP Domain Coordinates for d1iyu__:
Click to download the PDB-style file with coordinates for d1iyu__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iyu__:
- d1iyu__ appears in SCOP 1.57
- d1iyu__ appears in the current release, SCOPe 2.08, called d1iyua_
View in 3D