Lineage for d1iyua_ (1iyu A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2406232Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2406233Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2406234Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 protein domains)
  6. 2406246Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
    component of the pyruvate dehydrogenase complex
  7. 2406247Species Azotobacter vinelandii [TaxId:354] [51240] (2 PDB entries)
  8. 2406248Domain d1iyua_: 1iyu A: [28227]

Details for d1iyua_

PDB Entry: 1iyu (more details)

PDB Description: lipoyl domain of pyruvate dehydrogenase complex, nmr, minimized average structure
PDB Compounds: (A:) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex

SCOPe Domain Sequences for d1iyua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]}
seiirvpdiggdgeviellvktgdlieveqglvvlesakasmevpspkagvvksvsvklg
dklkegdaiielepaagar

SCOPe Domain Coordinates for d1iyua_:

Click to download the PDB-style file with coordinates for d1iyua_.
(The format of our PDB-style files is described here.)

Timeline for d1iyua_: