SCOPe 2.06: Domain d1dd2a_: 1dd2 A:

Lineage for d1dd2a_ (1dd2 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) [51234] (1 species)

7. Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [51235] (3 PDB entries)

8. Domain d1dd2a_: 1dd2 A: [28218]

Details for d1dd2a_

PDB Entry: 1dd2

PDB Description: biotin carboxyl carrier domain of transcarboxylase (tc 1.3s)

PDB Compounds: (A:) transcarboxylase 1.3s subunit

SCOPe Domain Sequences for d1dd2a_:

Sequence; same for both SEQRES and ATOM records:

>d1dd2a_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
agagkagegeipaplagtvskilvkegdtvkagqtvlvleamkmeteinaptdgkvekvl
vkerdavqggqglikig

Timeline for d1dd2a_:

• d1dd2a_ first appeared (with stable ids) in SCOP 1.55
  
• d1dd2a_ appears in SCOPe 2.05
  
• d1dd2a_ appears in SCOPe 2.07
  
• d1dd2a_ appears in the current release, SCOPe 2.08