Class b: All beta proteins [48724] (176 folds) |
Fold b.83: Triple beta-spiral [51224] (1 superfamily) trimer formed by the interlocking beta-hairpin repeat units |
Superfamily b.83.1: Fibre shaft of virus attachment proteins [51225] (3 families) |
Family b.83.1.1: Adenovirus [51226] (1 protein) |
Protein Adenovirus [51227] (1 species) |
Species Human adenovirus type 2 [TaxId:10515] [51228] (3 PDB entries) Uniprot P10104 |
Domain d1qiuf2: 1qiu F:319-395 [28213] Other proteins in same PDB: d1qiua1, d1qiub1, d1qiuc1, d1qiud1, d1qiue1, d1qiuf1 |
PDB Entry: 1qiu (more details), 2.4 Å
SCOPe Domain Sequences for d1qiuf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qiuf2 b.83.1.1 (F:319-395) Adenovirus {Human adenovirus type 2 [TaxId: 10515]} vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg aglsfdnsgaitignkn
Timeline for d1qiuf2: