Lineage for d1c9sd_ (1c9s D:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 234509Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 234742Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family) (S)
    shorter variant of double-helix
  5. 234743Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
  6. 234744Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 234745Species Bacillus stearothermophilus [TaxId:1422] [51223] (4 PDB entries)
  8. 234771Domain d1c9sd_: 1c9s D: [28178]

Details for d1c9sd_

PDB Entry: 1c9s (more details), 1.9 Å

PDB Description: crystal structure of a complex of trp rna-binding attenuation protein with a 53-base single stranded rna containing eleven gag triplets separated by au dinucleotides

SCOP Domain Sequences for d1c9sd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9sd_ b.82.5.1 (D:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus}
sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
hgviesegk

SCOP Domain Coordinates for d1c9sd_:

Click to download the PDB-style file with coordinates for d1c9sd_.
(The format of our PDB-style files is described here.)

Timeline for d1c9sd_: