SCOP 1.59: Domain d1wapv_: 1wap V:

Lineage for d1wapv_ (1wap V:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)

4. Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family)

5. Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)

6. Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [51222] (1 PDB entry)

8. Domain d1wapv_: 1wap V: [28174]

Details for d1wapv_

PDB Entry: 1wap, 1.8 Å

PDB Description: trp rna-binding attenuation protein in complex with l-tryptophan

SCOP Domain Sequences for d1wapv_:

Sequence; same for both SEQRES and ATOM records:

>d1wapv_ b.82.5.1 (V:) Trp RNA-binding attenuation protein (TRAP) {Bacillus subtilis}
dfvvikavedgvnvigltrgtdtkfhhsekldkgeviiaqftehtsaikvrgealiqtay
gemksek

Timeline for d1wapv_:

• d1wapv_ first appeared (with stable ids) in SCOP 1.55
  
• d1wapv_ appears in SCOP 1.57
  
• d1wapv_ appears in SCOP 1.61
  
• d1wapv_ appears in the current release, SCOPe 2.08