Lineage for d1wapf_ (1wap F:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115107Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 115264Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family) (S)
  5. 115265Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
  6. 115266Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 115301Species Bacillus subtilis [TaxId:1423] [51222] (1 PDB entry)
  8. 115307Domain d1wapf_: 1wap F: [28158]

Details for d1wapf_

PDB Entry: 1wap (more details), 1.8 Å

PDB Description: trp rna-binding attenuation protein in complex with l-tryptophan

SCOP Domain Sequences for d1wapf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wapf_ b.82.5.1 (F:) Trp RNA-binding attenuation protein (TRAP) {Bacillus subtilis}
dfvvikavedgvnvigltrgtdtkfhhsekldkgeviiaqftehtsaikvrgealiqtay
gemksekk

SCOP Domain Coordinates for d1wapf_:

Click to download the PDB-style file with coordinates for d1wapf_.
(The format of our PDB-style files is described here.)

Timeline for d1wapf_: