Lineage for d1wapm_ (1wap M:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2082359Superfamily b.82.5: TRAP-like [51219] (2 families) (S)
    shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains
  5. 2082360Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (2 proteins)
    oligomeric ring consists of 11 single-domain subunits
    automatically mapped to Pfam PF02081
  6. 2082361Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 2082521Species Bacillus subtilis [TaxId:1423] [51222] (1 PDB entry)
  8. 2082534Domain d1wapm_: 1wap M: [28165]
    protein/RNA complex; complexed with trp

Details for d1wapm_

PDB Entry: 1wap (more details), 1.8 Å

PDB Description: trp rna-binding attenuation protein in complex with l-tryptophan
PDB Compounds: (M:) trp RNA-binding attenuation protein

SCOPe Domain Sequences for d1wapm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wapm_ b.82.5.1 (M:) Trp RNA-binding attenuation protein (TRAP) {Bacillus subtilis [TaxId: 1423]}
dfvvikavedgvnvigltrgtdtkfhhsekldkgeviiaqftehtsaikvrgealiqtay
gemksekk

SCOPe Domain Coordinates for d1wapm_:

Click to download the PDB-style file with coordinates for d1wapm_.
(The format of our PDB-style files is described here.)

Timeline for d1wapm_: