Lineage for d1wapm_ (1wap M:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17821Fold b.82: Double-stranded beta-helix [51181] (5 superfamilies)
  4. 17936Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family) (S)
  5. 17937Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
  6. 17938Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 17973Species Bacillus subtilis [TaxId:1423] [51222] (1 PDB entry)
  8. 17986Domain d1wapm_: 1wap M: [28165]

Details for d1wapm_

PDB Entry: 1wap (more details), 1.8 Å

PDB Description: trp rna-binding attenuation protein in complex with l-tryptophan

SCOP Domain Sequences for d1wapm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wapm_ b.82.5.1 (M:) Trp RNA-binding attenuation protein (TRAP) {Bacillus subtilis}
dfvvikavedgvnvigltrgtdtkfhhsekldkgeviiaqftehtsaikvrgealiqtay
gemksekk

SCOP Domain Coordinates for d1wapm_:

Click to download the PDB-style file with coordinates for d1wapm_.
(The format of our PDB-style files is described here.)

Timeline for d1wapm_: