SCOP 1.63: Domain d1qiqa_: 1qiq A:

Lineage for d1qiqa_ (1qiq A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (6 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.1: Penicillin syntase-like [51198] (3 proteins)
   common fold is rather distorted

6. Protein Isopenicillin N synthase [51199] (1 species)

7. Species Emericella nidulans [TaxId:162425] [51200] (10 PDB entries)

8. Domain d1qiqa_: 1qiq A: [28121]
   complexed with acc, fe, so4

Details for d1qiqa_

PDB Entry: 1qiq, 1.5 Å

PDB Description: isopenicillin n synthase from aspergillus nidulans (acmc fe complex)

SCOP Domain Sequences for d1qiqa_:

Sequence; same for both SEQRES and ATOM records:

>d1qiqa_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans}
vskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefhm
sitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktpt
hevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtlas
vvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdie
addtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprepn
gksdreplsygdylqnglvslinkngqt

Timeline for d1qiqa_:

• d1qiqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1qiqa_ appears in SCOP 1.61
  
• d1qiqa_ appears in SCOP 1.65
  
• d1qiqa_ appears in the current release, SCOPe 2.08