Lineage for d1caxd_ (1cax D:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115107Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 115108Superfamily b.82.1: RmlC-like [51182] (4 families) (S)
  5. 115119Family b.82.1.2: Germin/Seed storage 7S protein [51187] (2 proteins)
  6. 115123Protein Seed storage 7S protein [51188] (3 species)
  7. 115133Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries)
  8. 115151Domain d1caxd_: 1cax D: [28107]

Details for d1caxd_

PDB Entry: 1cax (more details), 2.6 Å

PDB Description: determination of three crystal structures of canavalin by molecular replacement

SCOP Domain Sequences for d1caxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1caxd_ b.82.1.2 (D:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin}
tlssqdkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphyns
ratvilvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaas
dlnmvgigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvd
gqpr

SCOP Domain Coordinates for d1caxd_:

Click to download the PDB-style file with coordinates for d1caxd_.
(The format of our PDB-style files is described here.)

Timeline for d1caxd_: