SCOP 1.69: Domain d1dgrc_: 1dgr C:

Lineage for d1dgrc_ (1dgr C:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (13 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries)

8. Domain d1dgrc_: 1dgr C: [28100]

Details for d1dgrc_

PDB Entry: 1dgr, 2.6 Å

PDB Description: Refined crystal structure of canavalin from jack bean

SCOP Domain Sequences for d1dgrc_:

Sequence; same for both SEQRES and ATOM records:

>d1dgrc_ b.82.1.2 (C:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin}
nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp

Timeline for d1dgrc_:

• d1dgrc_ first appeared (with stable ids) in SCOP 1.55
  
• d1dgrc_ appears in SCOP 1.67
  
• d1dgrc_ appears in SCOP 1.71
  
• d1dgrc_ appears in the current release, SCOPe 2.08