SCOP 1.73: Domain d1dztb_: 1dzt B:

Lineage for d1dztb_ (1dzt B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (20 families)

5. Family b.82.1.1: dTDP-sugar isomerase [51183] (3 proteins)

6. Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
   synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase

7. Species Salmonella typhimurium [TaxId:90371] [51185] (2 PDB entries)

8. Domain d1dztb_: 1dzt B: [28079]
   complexed with aty, gol, so4, tpe

Details for d1dztb_

PDB Entry: 1dzt, 2.2 Å

PDB Description: rmlc from salmonella typhimurium

PDB Compounds: (B:) dtdp-4-dehydrorhamnose 3,5-epimerase

SCOP Domain Sequences for d1dztb_:

Sequence; same for both SEQRES and ATOM records:

>d1dztb_ b.82.1.1 (B:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 602]}
mmiviktaipdvlilepkvfgdergfffesynqqtfeeligrkvtfvqdnhskskknvlr
glhfqrgenaqgklvrcavgevfdvavdirkesptfgqwvgvnlsaenkrqlwipegfah
gfvtlseyaeflykatnyyspssegsilwndeaigiewpfsqlpelsakdaaaplldqal
lte

Timeline for d1dztb_:

• d1dztb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dztb_ appears in SCOP 1.71
  
• d1dztb_ appears in SCOP 1.75
  
• d1dztb_ appears in the current release, SCOPe 2.08