SCOPe 2.07: Domain d1fxjb1: 1fxj B:252-326

Lineage for d1fxjb1 (1fxj B:252-326)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
   this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain

6. Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (3 species)

7. Species Escherichia coli [TaxId:562] [51173] (6 PDB entries)

8. Domain d1fxjb1: 1fxj B:252-326 [28063]
   Other proteins in same PDB: d1fxja2, d1fxjb2
   truncated form after R331
   complexed with mes, so4

Details for d1fxjb1

PDB Entry: 1fxj, 2.25 Å

PDB Description: crystal structure of n-acetylglucosamine 1-phosphate uridyltransferase

PDB Compounds: (B:) udp-n-acetylglucosamine pyrophosphorylase

SCOPe Domain Sequences for d1fxjb1:

Sequence; same for both SEQRES and ATOM records:

>d1fxjb1 b.81.1.4 (B:252-326) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]}
vmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvigddceisp
ytvvedanlaaacti

Timeline for d1fxjb1:

• d1fxjb1 first appeared (with stable ids) in SCOP 1.55
  
• d1fxjb1 appears in SCOPe 2.06
  
• d1fxjb1 appears in the current release, SCOPe 2.08