Lineage for d1fxjb1 (1fxj B:252-326)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17776Fold b.81: Single-stranded left-handed beta-helix [51160] (2 superfamilies)
  4. 17777Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (5 families) (S)
  5. 17795Family b.81.1.4: N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51171] (1 protein)
    this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain
  6. 17796Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (1 species)
  7. 17797Species Escherichia coli [TaxId:562] [51173] (3 PDB entries)
  8. 17801Domain d1fxjb1: 1fxj B:252-326 [28063]
    Other proteins in same PDB: d1fxja2, d1fxjb2

Details for d1fxjb1

PDB Entry: 1fxj (more details), 2.25 Å

PDB Description: crystal structure of n-acetylglucosamine 1-phosphate uridyltransferase

SCOP Domain Sequences for d1fxjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxjb1 b.81.1.4 (B:252-326) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli}
vmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvigddceisp
ytvvedanlaaacti

SCOP Domain Coordinates for d1fxjb1:

Click to download the PDB-style file with coordinates for d1fxjb1.
(The format of our PDB-style files is described here.)

Timeline for d1fxjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fxjb2