SCOPe 2.06: Domain d5etxd1: 5etx D:1006-1180

Lineage for d5etxd1 (5etx D:1006-1180)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (6 species)
   not a true protein

7. Species Hepatitis C virus [TaxId:11103] [189262] (11 PDB entries)

8. Domain d5etxd1: 5etx D:1006-1180 [280363]
   Other proteins in same PDB: d5etxa2, d5etxb2, d5etxc2, d5etxd2
   automated match to d3sv9a_
   complexed with 5rs, cl, zn

Details for d5etxd1

PDB Entry: 5etx, 2.35 Å

PDB Description: crystal structure of hcv ns3/4a protease a156t variant in complex with 5172-linear (mk-5172 linear analogue)

PDB Compounds: (D:) NS3 protease

SCOPe Domain Sequences for d5etxd1:

Sequence; same for both SEQRES and ATOM records:

>d5etxd1 b.47.1.3 (D:1006-1180) automated matches {Hepatitis C virus [TaxId: 11103]}
yaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsingvlwtvyhgagtrtia
spkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtrhadvipvrrrgdsrgs
llsprpisylkgssggpllcpaghavgifrtavstrgvakavdfipveslettmr

Timeline for d5etxd1:

• d5etxd1 first appeared in SCOPe 2.05, called d5etxd_
  
• d5etxd1 appears in SCOPe 2.07
  
• d5etxd1 appears in the current release, SCOPe 2.08