Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein automated matches [190658] (6 species) not a true protein |
Species Hepatitis C virus [TaxId:11103] [189262] (11 PDB entries) |
Domain d5etxd1: 5etx D:1006-1180 [280363] Other proteins in same PDB: d5etxa2, d5etxb2, d5etxc2, d5etxd2 automated match to d3sv9a_ complexed with 5rs, cl, zn |
PDB Entry: 5etx (more details), 2.35 Å
SCOPe Domain Sequences for d5etxd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5etxd1 b.47.1.3 (D:1006-1180) automated matches {Hepatitis C virus [TaxId: 11103]} yaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsingvlwtvyhgagtrtia spkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtrhadvipvrrrgdsrgs llsprpisylkgssggpllcpaghavgifrtavstrgvakavdfipveslettmr
Timeline for d5etxd1: