SCOPe 2.07: Domain d5df7a2: 5df7 A:222-564

Lineage for d5df7a2 (5df7 A:222-564)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196777] (34 PDB entries)

8. Domain d5df7a2: 5df7 A:222-564 [280310]
   Other proteins in same PDB: d5df7a1, d5df7b1
   automated match to d4kqra2
   complexed with 59h, cl, gol, imd

Details for d5df7a2

PDB Entry: 5df7, 2 Å

PDB Description: crystal structure of penicillin-binding protein 3 from pseudomonas aeruginosa in complex with azlocillin

PDB Compounds: (A:) Cell division protein

SCOPe Domain Sequences for d5df7a2:

Sequence; same for both SEQRES and ATOM records:

>d5df7a2 e.3.1.0 (A:222-564) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
sidlrlqylahrelrnallengakagslvimdvktgeilamtnqptynpnnrrnlqpaam
rnramidvfepgstvkpfsmsaalasgrwkpsdivdvypgtlqigrytirdvsrnsrqld
ltgilikssnvgiskiafdigaesiysvmqqvglgqdtglgfpgervgnlpnhrkwpkae
tatlaygyglsvtaiqlahayaalandgksvplsmtrvdrvpdgvqvispevastvqgml
qqvveaqggvfraqvpgyhaagksgtarkvsvgtkgyrenayrslfagfapatdpriamv
vvidepskagyfgglvsapvfskvmagalrlmnvppdnlptat

Timeline for d5df7a2:

• d5df7a2 first appeared in SCOPe 2.05
  
• d5df7a2 appears in SCOPe 2.06
  
• d5df7a2 appears in the current release, SCOPe 2.08