SCOPe 2.07: Domain d5df7b1: 5df7 B:57-221

Lineage for d5df7b1 (5df7 B:57-221)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.0: automated matches [227232] (1 protein)
   not a true family

6. Protein automated matches [226981] (13 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [234430] (7 PDB entries)

8. Domain d5df7b1: 5df7 B:57-221 [280304]
   Other proteins in same PDB: d5df7a2, d5df7b2
   automated match to d4kqra1
   complexed with 59h, cl, gol, imd

Details for d5df7b1

PDB Entry: 5df7, 2 Å

PDB Description: crystal structure of penicillin-binding protein 3 from pseudomonas aeruginosa in complex with azlocillin

PDB Compounds: (B:) Cell division protein

SCOPe Domain Sequences for d5df7b1:

Sequence, based on SEQRES records:

>d5df7b1 d.175.1.0 (B:57-221) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
aipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklfadrieq
naerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdvddrgre
gielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal

Sequence, based on observed residues (ATOM records):

>d5df7b1 d.175.1.0 (B:57-221) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
aipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklfadrieq
naerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdvddrgre
gielafdewlagvpgkrknakpgktlal

Timeline for d5df7b1:

• d5df7b1 first appeared in SCOPe 2.05
  
• d5df7b1 appears in SCOPe 2.06
  
• d5df7b1 appears in the current release, SCOPe 2.08