![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
![]() | Protein automated matches [190197] (24 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:158878] [280201] (7 PDB entries) |
![]() | Domain d4y1ga1: 4y1g A:2-171 [280208] Other proteins in same PDB: d4y1ga2, d4y1gb2 automated match to d1oi4a1 |
PDB Entry: 4y1g (more details), 1.9 Å
SCOPe Domain Sequences for d4y1ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y1ga1 c.23.16.0 (A:2-171) automated matches {Staphylococcus aureus [TaxId: 158878]} tkkvaiilanefedinysspkealenagfntvvigdtansevvgkhgekvtvdvgiaeak pedydallipggfspdhlrgdtegrygtfakyftkndvptfaichgpqilidtddlkgrt ltavlnvrkdlsnagahvvdesvvvdnnivtsrvpddlddfnreivkqlq
Timeline for d4y1ga1: