Lineage for d4y1ga1 (4y1g A:2-171)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117752Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2118193Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2118194Protein automated matches [190197] (20 species)
    not a true protein
  7. 2118361Species Staphylococcus aureus [TaxId:158878] [280201] (7 PDB entries)
  8. 2118368Domain d4y1ga1: 4y1g A:2-171 [280208]
    Other proteins in same PDB: d4y1ga2, d4y1gb2
    automated match to d1oi4a1

Details for d4y1ga1

PDB Entry: 4y1g (more details), 1.9 Å

PDB Description: sav1875-e17n
PDB Compounds: (A:) Uncharacterized protein SAV1875

SCOPe Domain Sequences for d4y1ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y1ga1 c.23.16.0 (A:2-171) automated matches {Staphylococcus aureus [TaxId: 158878]}
tkkvaiilanefedinysspkealenagfntvvigdtansevvgkhgekvtvdvgiaeak
pedydallipggfspdhlrgdtegrygtfakyftkndvptfaichgpqilidtddlkgrt
ltavlnvrkdlsnagahvvdesvvvdnnivtsrvpddlddfnreivkqlq

SCOPe Domain Coordinates for d4y1ga1:

Click to download the PDB-style file with coordinates for d4y1ga1.
(The format of our PDB-style files is described here.)

Timeline for d4y1ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4y1ga2