SCOPe 2.07: Domain d4wdqa1: 4wdq A:2-296

Lineage for d4wdqa1 (4wdq A:2-296)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein Haloalkane dehalogenase [53514] (4 species)

7. Species Sphingobium japonicum [TaxId:452662] [280075] (1 PDB entry)

8. Domain d4wdqa1: 4wdq A:2-296 [280076]
   Other proteins in same PDB: d4wdqa2
   automated match to d1mj5a_
   complexed with cl, mg; mutant

Details for d4wdqa1

PDB Entry: 4wdq, 1.58 Å

PDB Description: crystal structure of haloalkane dehalogenase linb32 mutant (l177w) from sphingobium japonicum ut26

PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d4wdqa1:

Sequence; same for both SEQRES and ATOM records:

>d4wdqa1 c.69.1.8 (A:2-296) Haloalkane dehalogenase {Sphingobium japonicum [TaxId: 452662]}
slgakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliac
dligmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrh
rervqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpgwilrp
lseaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklfi
naepgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpa

Timeline for d4wdqa1:

• d4wdqa1 first appeared in SCOPe 2.05, called d4wdqa_
  
• d4wdqa1 appears in SCOPe 2.06
  
• d4wdqa1 appears in the current release, SCOPe 2.08