Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins) |
Protein Haloalkane dehalogenase [53514] (4 species) |
Species Sphingobium japonicum [TaxId:452662] [280075] (1 PDB entry) |
Domain d4wdqa1: 4wdq A:2-296 [280076] Other proteins in same PDB: d4wdqa2 automated match to d1mj5a_ complexed with cl, mg; mutant |
PDB Entry: 4wdq (more details), 1.58 Å
SCOPe Domain Sequences for d4wdqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wdqa1 c.69.1.8 (A:2-296) Haloalkane dehalogenase {Sphingobium japonicum [TaxId: 452662]} slgakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliac dligmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrh rervqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpgwilrp lseaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklfi naepgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpa
Timeline for d4wdqa1: