SCOPe 2.07: Domain d5f4cb1: 5f4c B:1-90

Lineage for d5f4cb1 (5f4c B:1-90)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.1: Barstar-related [52038] (1 family)
   automatically mapped to Pfam PF01337

5. Family c.9.1.1: Barstar-related [52039] (3 proteins)

6. Protein automated matches [190697] (2 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [280029] (1 PDB entry)

8. Domain d5f4cb1: 5f4c B:1-90 [280030]
   Other proteins in same PDB: d5f4cb2
   automated match to d2cx6a1
   complexed with mli

Details for d5f4cb1

PDB Entry: 5f4c, 1.4 Å

PDB Description: crystal structure of ribonuclease inhibitor barstar from salmonella typhimurium

PDB Compounds: (B:) putative cytoplasmic protein

SCOPe Domain Sequences for d5f4cb1:

Sequence; same for both SEQRES and ATOM records:

>d5f4cb1 c.9.1.1 (B:1-90) automated matches {Salmonella typhimurium [TaxId: 99287]}
mnvytfdfndiknqsdfyreftqtfglasekvsdldtlwdavmsdilplpleiefvhlpd
klrrrygalillfdeaeeelegrlrfnvrh

Timeline for d5f4cb1:

• d5f4cb1 first appeared in SCOPe 2.05, called d5f4cb_
  
• d5f4cb1 appears in SCOPe 2.06
  
• d5f4cb1 appears in the current release, SCOPe 2.08