| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
Superfamily c.9.1: Barstar-related [52038] (1 family) ![]() automatically mapped to Pfam PF01337 |
| Family c.9.1.1: Barstar-related [52039] (3 proteins) |
| Protein automated matches [190697] (2 species) not a true protein |
| Species Salmonella typhimurium [TaxId:99287] [280029] (1 PDB entry) |
| Domain d5f4cb1: 5f4c B:1-90 [280030] Other proteins in same PDB: d5f4cb2 automated match to d2cx6a1 complexed with mli |
PDB Entry: 5f4c (more details), 1.4 Å
SCOPe Domain Sequences for d5f4cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f4cb1 c.9.1.1 (B:1-90) automated matches {Salmonella typhimurium [TaxId: 99287]}
mnvytfdfndiknqsdfyreftqtfglasekvsdldtlwdavmsdilplpleiefvhlpd
klrrrygalillfdeaeeelegrlrfnvrh
Timeline for d5f4cb1: